PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn100041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 339aa    MW: 36584.1 Da    PI: 8.3884
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn100041genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.17.2e-12100144347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ I+r     Rt+ q+ s+ qky
       Achn100041 100 PWTEEEHRMFLLGLQKLGKGDWRGISRNYVISRTPTQVASHAQKY 144
                      8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.40293149IPR017930Myb domain
SuperFamilySSF466896.28E-1795150IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-1996148IPR006447Myb domain, plants
SMARTSM007171.9E-1097147IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-1197143IPR009057Homeodomain-like
CDDcd001677.24E-9100145No hitNo description
PfamPF002492.7E-10100144IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MTRRCSHCYH NGHNSRTCPN RGVKLFGVRL TDGSIRKSAS MGNLNHYIGS GSVTPQIGAA  60
AAANHRDSPG DTPDHDGGGY ASEDFVPGTS TSRERKKGVP WTEEEHRMFL LGLQKLGKGD  120
WRGISRNYVI SRTPTQVASH AQKYFIRQSN MSRRKRRSSL FDIVSDESVE APIAPQDFFT  180
ISVNPPQAET LAKNLLPPAP VLDGECESMD SSNSNDEEPV PQRPDSSQCC YPVVIPTFIS  240
PVLPFSIPLW PRHTTMPVKA ETHEVLKPTA VHSKSPINVD ELVGMSKLSL GGESLANAGP  300
STLSLKLVEG SGRQSAFHAN PASGSSLVNL SVNPIHAV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006477144.11e-176PREDICTED: transcription factor MYB1R1
TrEMBLA0A067FDS71e-172A0A067FDS7_CITSI; Uncharacterized protein
STRINGVIT_00s0299g00060.t011e-165(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70622431
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-122MYB_related family protein